Antibodies

View as table Download

PLP1 chicken polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide KLH conjugated corresponding to a sequence shared between the Mouse (P60202) and Human (NP_000524) gene products.
Production: After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks, and then affinity-purified using a peptide column. The concentrations of the eluates were then adjusted to 0.1 mg/ml, and the preparation was filter-sterilized.

PLP1 (C-term) mouse monoclonal antibody, clone plpc1, Purified

Applications FC, IF, IHC, WB
Reactivities Bovine, Human

Rabbit Polyclonal Anti-PLP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the N terminal of human PLP1. Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL

Rabbit Polyclonal Anti-PLP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the middle region of human PLP1. Synthetic peptide located within the following region: IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ

PLP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1).
Modifications Unmodified

PLP1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1).
Modifications Unmodified