Antibodies

View as table Download

Rabbit Polyclonal Anti-Pomgnt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pomgnt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR

Rabbit polyclonal antibody to POMGNT1 (protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase)

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 98 and 373 of POMGNT1 (Uniprot ID#Q8WZA1)

POMGNT1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human POMGNT1

POMGNT1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human POMGNT1

POMGNT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 411-660 of human POMGNT1 (NP_060209.3).
Modifications Unmodified