Antibodies

Jump to Filters
View as table Download
PPCDC Rabbit Polyclonal Antibody
TA339355

USD 310.00

5 Days

Rabbit Polyclonal Anti-PPCDC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPCDC antibody: synthetic peptide directed towards the N terminal of human PPCDC. Synthetic peptide located within the following region: VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV
PPCDC Rabbit Polyclonal Antibody
TA370324

USD 380.00

4 Weeks

PPCDC rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein