PPCDC Rabbit Polyclonal Antibody

CAT#: TA339355

Rabbit Polyclonal Anti-PPCDC Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PPCDC"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PPCDC antibody: synthetic peptide directed towards the N terminal of human PPCDC. Synthetic peptide located within the following region: VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 22 kDa
Gene Name phosphopantothenoylcysteine decarboxylase
Background Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC (EC 4.1.1.36), one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine (Daugherty et al., 2002 [PubMed 11923312]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (4) lacks two alternate in-frame exons in the central coding region, compared to variant 1, resulting in an isoform (d) that is shorter than isoform a. ##Evidence-Data-START## Transcript exon combination :: BI833814.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms coaC; MDS018; PPC-DC
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%
Reference Data
Protein Pathways Metabolic pathways, Pantothenate and CoA biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.