Antibodies

View as table Download

Rabbit polyclonal anti-ASPP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal sequence of human ASPP1.

Rabbit Polyclonal Anti-PPP1R13B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R13B antibody: synthetic peptide directed towards the middle region of human PPP1R13B. Synthetic peptide located within the following region: EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA

Sheep polyclonal anti-ASPP1 antibody

Reactivities Human
Conjugation Unconjugated
Immunogen ASPP1

Anti-ASPP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 478-491 amino acids of Human Apoptosis-stimulating amino acids of p53 protein 1

PPP1R13B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PPP1R13B

PPP1R13B Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human PPP1R13B (NP_056131.2).
Modifications Unmodified