Antibodies

View as table Download

Rabbit Polyclonal Anti-PRDM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRDM5 antibody is: synthetic peptide directed towards the N-terminal region of Human PRDM5. Synthetic peptide located within the following region: MGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYI

Rabbit Polyclonal Anti-PRDM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM5 antibody: synthetic peptide directed towards the middle region of human PRDM5. Synthetic peptide located within the following region: DVCDLAFSLKKMLIRHKMTHNPNRPLAECQFCHKKFTRNDYLKVHMDNIH

Rabbit Polyclonal Anti-PRDM5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM5 antibody: synthetic peptide directed towards the N terminal of human PRDM5. Synthetic peptide located within the following region: GPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFV

PRDM5 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2).
Modifications Unmodified