PRDM5 Rabbit Polyclonal Antibody

CAT#: TA331191

Rabbit Polyclonal Anti-PRDM5 Antibody

Product Images

WB Suggested Anti-PRDM5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 721_B cell lysate

• 

  Immunohistochemistry with Human Small Intestine tissue at an antibody concentration of 5.0ug/ml using anti-PRDM5 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRDM5 antibody: synthetic peptide directed towards the N terminal of human PRDM5. Synthetic peptide located within the following region: GPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: PR domain 5
• Database Link:
  NP_061169
  Entrez Gene 11107 Human
  UniProt ID Q9NQX1
• Background: PRDM5 is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis. The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis.
• Synonyms: BCS2; PFM2
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors