Rabbit Polyclonal antibody to PRPSAP2 (phosphoribosyl pyrophosphate synthetase-associated protein 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 369 of PRPSAP2 (Uniprot ID#O60256) |
Rabbit polyclonal Anti-PRPSAP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRPSAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human PRPSAP2. Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ |
Rabbit polyclonal Anti-PRPSAP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPSAP2 antibody: synthetic peptide directed towards the middle region of human PRPSAP2. Synthetic peptide located within the following region: DYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSP |
PRPSAP2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PRPSAP2 (NP_002758.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
