PRR7 (C-term) mouse monoclonal antibody, clone TRAP3/10, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
PRR7 (C-term) mouse monoclonal antibody, clone TRAP3/10, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-PRR7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRR7 antibody: synthetic peptide directed towards the middle region of human PRR7. Synthetic peptide located within the following region: AEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRG |
PRR7 Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse PRR7 |