PRR7 Rabbit Polyclonal Antibody

CAT#: TA337964

Rabbit Polyclonal Anti-PRR7 Antibody

Product Images

WB Suggested Anti-PRR7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Jurkat cell lysate

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRR7 antibody: synthetic peptide directed towards the middle region of human PRR7. Synthetic peptide located within the following region: AEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: proline rich 7 (synaptic)
• Database Link:
  NP_085044
  Entrez Gene 80758 Human
  UniProt ID Q8TB68
• Background: PRR7 encodes a proline-rich membrane protein which is involved in modulating neural activities via interactions with the NMDA receptor and PSD-95, and PSD core formation.
• Synonyms: MGC10772
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane