Antibodies

Jump to Filters
View as table Download
PRSS33 Rabbit Polyclonal Antibody
TA316286

USD 345.00

In Stock

Rabbit polyclonal anti-PRSS33 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRSS33.
PRSS33 Rabbit Polyclonal Antibody
TA331618

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRSS33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRSS33 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS33. Synthetic peptide located within the following region: GYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSV