PRSS33 Rabbit Polyclonal Antibody

CAT#: TA331618

Rabbit Polyclonal Anti-PRSS33 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PRSS33"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PRSS33 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS33. Synthetic peptide located within the following region: GYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name protease, serine 33
Background PRSS33 is a Serine protease that has amidolytic activity, cleaving its substrates before Arg residues.
Synonyms EOS
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Protein Families Druggable Genome, Protease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.