Rabbit Polyclonal Anti-PSG5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSG5 antibody: synthetic peptide directed towards the N terminal of human PSG5. Synthetic peptide located within the following region: QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY |
Rabbit Polyclonal Anti-PSG5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSG5 antibody: synthetic peptide directed towards the middle region of human PSG5. Synthetic peptide located within the following region: SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI |
Germany
Japan
United Kingdom
China