PSG5 Rabbit Polyclonal Antibody

CAT#: TA346330

Rabbit Polyclonal Anti-PSG5 Antibody

Product Images

WB Suggested Anti-PSG5 Antibody Titration: 2.5 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSG5 antibody: synthetic peptide directed towards the N terminal of human PSG5. Synthetic peptide located within the following region: QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: pregnancy specific beta-1-glycoprotein 5
• Database Link:
  NP_002772
  Entrez Gene 5673 Human
  UniProt ID Q15238
• Background: The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown.
• Synonyms: FL-NCA-3; PSG
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 85%; Mouse: 85%; Dog: 77%; Horse: 77%

Reference Data

• Protein Families: Secreted Protein