Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-PSMB2 antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PSMB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 133-163 amino acids from the C-terminal region of human PSMB2. |
Rabbit polyclonal Anti-PSMB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB2 antibody: synthetic peptide directed towards the middle region of human PSMB2. Synthetic peptide located within the following region: YDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERA |
Rabbit polyclonal Anti-PSMB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB2 antibody: synthetic peptide directed towards the middle region of human PSMB2. Synthetic peptide located within the following region: LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD |
PSMB2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PSMB2 |
PSMB2 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human PSMB2 (NP_002785.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PSMB2