Germany
Japan
United Kingdom
China
Rabbit anti-PSMC2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMC2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PSMC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMC2 Antibody: synthetic peptide directed towards the N terminal of human PSMC2. Synthetic peptide located within the following region: MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVED |
Rabbit Polyclonal Anti-PSMC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMC2 Antibody: synthetic peptide directed towards the N terminal of human PSMC2. Synthetic peptide located within the following region: MPDYLGADQRKTKEVEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVED |
Rabbit Polyclonal Anti-PSMC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PSMC2 |
PSMC2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PSMC2 |
Active filters
Target Symbol
- PSMC2