PSMC2 Rabbit Polyclonal Antibody

CAT#: TA335805

Rabbit Polyclonal Anti-PSMC2 Antibody

Product Images

WB Suggested Anti-PSMC2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PSMC2 Antibody: synthetic peptide directed towards the N terminal of human PSMC2. Synthetic peptide located within the following region: MPDYLGADQRKTKEVEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: proteasome 26S subunit, ATPase 2
• Database Link:
  NP_002794
  Entrez Gene 5701 Human
  UniProt ID P35998
• Background: PSMC2 is one of the ATPase subunits. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This su
• Synonyms: MSS1; Nbla10058; S7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 93%

Reference Data

• Protein Pathways: Proteasome