Rabbit Polyclonal Anti-PSMD10 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PSMD10 |
Rabbit Polyclonal Anti-PSMD10 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PSMD10 |
PSMD10 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMD10 |
Rabbit polyclonal Anti-PSMD10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMD10 antibody: synthetic peptide directed towards the middle region of human PSMD10. Synthetic peptide located within the following region: MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLV |
Rabbit Polyclonal Antibody against Gankyrin
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human gankyrin protein sequence (between residues 100-200). UniProt O75832 |
Carrier-free (BSA/glycerol-free) PSMD10 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Psmd10 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
PSMD10 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 127-226 of human PSMD10 (NP_002805.1). |
Modifications | Unmodified |
Anti-PSMD10 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PSMD10 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-PSMD10 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PSMD10 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |