PSMD10 Rabbit Polyclonal Antibody

CAT#: TA342177

Rabbit polyclonal Anti-PSMD10 Antibody

Product Images

WB Suggested Anti-PSMD10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMD10 antibody: synthetic peptide directed towards the middle region of human PSMD10. Synthetic peptide located within the following region: MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: proteasome 26S subunit, non-ATPase 10
• Database Link:
  NP_002805
  Entrez Gene 5716 Human
  UniProt ID O75832
• Background: This gene encodes a subunit ofThe PA700/19S complex, which isThe regulatory component ofThe 26S proteasome.The 26S proteosome complex is required for ubiquitin-dependent protein degradation.This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression ofThis gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20. [provided by RefSeq, Mar 2011]
• Synonyms: dJ889N15.2; p28; p28(GANK)
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%