Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EBP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 228-255 amino acids from the Central region of human EBP1. |
Rabbit Polyclonal Anti-PA2G4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the C terminal of human PA2G4. Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ |
Rabbit Polyclonal Anti-PA2G4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the middle region of human PA2G4. Synthetic peptide located within the following region: NCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVD |
PA2G4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human PA2G4 |
Pa2g4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
PA2G4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PA2G4 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- PA2G4