Antibodies

View as table Download

Pannexin 3 (PANX3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 2-31 amino acids from the N-terminal region of Human PANX3

Rabbit Polyclonal anti-PANX3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANX3 antibody: synthetic peptide directed towards the middle region of human PANX3. Synthetic peptide located within the following region: IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL