Pannexin 3 (PANX3) Rabbit Polyclonal Antibody

CAT#: TA329534

Rabbit Polyclonal anti-PANX3 antibody

Product Images

WB Suggested Anti-PANX3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PANX3 antibody: synthetic peptide directed towards the middle region of human PANX3. Synthetic peptide located within the following region: IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: pannexin 3
• Database Link:
  NP_443191
  Entrez Gene 116337 Human
  UniProt ID Q96QZ0
• Background: The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions.
• Synonyms: PX3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane