Antibodies

Jump to Filters
View as table Download
PATE4 Rabbit Polyclonal Antibody
TA332181

USD 375.00

5 Days

Rabbit Polyclonal Anti-PATE4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PATE4 Antibody is: synthetic peptide directed towards the middle region of Human PATE4. Synthetic peptide located within the following region: KENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFC