PATE4 Rabbit Polyclonal Antibody

CAT#: TA332181

Rabbit Polyclonal Anti-PATE4 Antibody

Product Images

Host: Rabbit; Target Name: PATE4; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PATE4 Antibody is: synthetic peptide directed towards the middle region of Human PATE4. Synthetic peptide located within the following region: KENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 10 kDa
• Gene Name: prostate and testis expressed 4
• Database Link:
  NP_001138346
  Entrez Gene 399968 Human
  UniProt ID P0C8F1
• Background: PATE4 may modulate the function of nicotinic acetylcholine receptors and may enhance sperm motility.
• Synonyms: PATE-B
• Note: Immunogen sequence homology: Human: 100%