Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against PCGF3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PLLLHYRPKMDLL, from the C Terminus of the protein sequence according to NP_006306. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PCGF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCGF3 Antibody: synthetic peptide directed towards the middle region of human PCGF3. Synthetic peptide located within the following region: EVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSD |
Rabbit Polyclonal Anti-PCGF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCGF3 Antibody: synthetic peptide directed towards the middle region of human PCGF3. Synthetic peptide located within the following region: FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEED |
PCGF3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-242 of human PCGF3 (NP_006306.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PCGF3