PCGF3 Rabbit Polyclonal Antibody

CAT#: TA335694

Rabbit Polyclonal Anti-PCGF3 Antibody

Product Images

WB Suggested Anti-PCGF3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCGF3 Antibody: synthetic peptide directed towards the middle region of human PCGF3. Synthetic peptide located within the following region: EVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: polycomb group ring finger 3
• Database Link:
  NP_006306
  Entrez Gene 10336 Human
  UniProt ID Q3KNV8
• Background: PCGF3 contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined.
• Synonyms: DONG1; RNF3; RNF3A
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Horse: 79%; Guinea pig: 79%; Yeast: 75%