PDE3A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | PDE3A antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (94%). |
PDE3A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | PDE3A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE3A. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Horse (83%). |
PDE3A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Mouse, Rat, Horse, Gibbon |
| Immunogen | PDE3A antibody was raised against synthetic 17 amino acid peptide from internal region of human PDE3A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Horse, Opossum (100%); Chicken (88%). |
Rabbit Polyclonal Anti-PDE3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD |
PDE3A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 380-660 of human PDE3A (NP_000912.3). |
Germany
Japan
United Kingdom
China