Germany
Japan
United Kingdom
China
PEMT rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PEMT |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PEMT Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PEMT Antibody: synthetic peptide directed towards the C terminal of human PEMT. Synthetic peptide located within the following region: GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS |
PEMT Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse PEMT |
PEMT rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PEMT |
Active filters
Target Symbol
- PEMT