Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to PGAM1 (phosphoglycerate mutase 1 (brain))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 191 and 254 of PGAM1 (Uniprot ID#P18669) |
Goat Polyclonal Antibody against PGAM1 / PGAM2 / PGAM4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KAMEAVAAQGKAKK, from the C Terminus of the protein sequence according to NP_002620.1; NP_000281.2; NP_001025062.1. |
Rabbit Polyclonal Anti-PGAM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGAM1 antibody is: synthetic peptide directed towards the C-terminal region of Human PGAM1. Synthetic peptide located within the following region: EEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGK |
PGAM1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PGAM1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PGAM1 |
PGAM1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-254 of human PGAM1 (NP_002620.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PGAM1