Rabbit Polyclonal Anti-PGS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGS1 antibody: synthetic peptide directed towards the C terminal of human PGS1. Synthetic peptide located within the following region: QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP |
Rabbit Polyclonal Anti-PGS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGS1 antibody: synthetic peptide directed towards the C terminal of human PGS1. Synthetic peptide located within the following region: RVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEA |
PGS1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 207-556 of human PGS1 (NP_077733.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
