PGS1 Rabbit Polyclonal Antibody

CAT#: TA346821

Rabbit Polyclonal Anti-PGS1 Antibody

Product Images

WB Suggested Anti-PGS1 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGS1 antibody: synthetic peptide directed towards the C terminal of human PGS1. Synthetic peptide located within the following region: RVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: phosphatidylglycerophosphate synthase 1
• Database Link:
  NP_077733
  Entrez Gene 9489 Human
  UniProt ID Q32NB8
• Background: Functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.
• Synonyms: DKFZp762M186; MGC131960
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways