Antibodies

Jump to Filters
View as table Download
PHETA1 (N-term) Rabbit Polyclonal Antibody
AP51519PU-N

USD 512.00

2 Weeks

PHETA1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 10-39 amino acids from the N-terminal region of human FAM109A
PHETA1 Rabbit Polyclonal Antibody
TA340351

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM109A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM109A antibody: synthetic peptide directed towards the N terminal of human FAM109A. Synthetic peptide located within the following region: HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA