Antibodies

Jump to Filters
View as table Download
PIGL (N-term) Rabbit Polyclonal Antibody
AP53297PU-N

USD 450.00

2 Weeks

PIGL (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 7-37aa) of human PIGL.
PIGL Rabbit Polyclonal Antibody
TA339405

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIGL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGL antibody: synthetic peptide directed towards the N terminal of human PIGL. Synthetic peptide located within the following region: MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP