PIGL Rabbit Polyclonal Antibody

CAT#: TA339405

Rabbit Polyclonal Anti-PIGL Antibody

Product Images

WB Suggested Anti-PIGL Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate.PIGL is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIGL antibody: synthetic peptide directed towards the N terminal of human PIGL. Synthetic peptide located within the following region: MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: phosphatidylinositol glycan anchor biosynthesis class L
• Database Link:
  NP_004269
  Entrez Gene 9487 Human
  UniProt ID Q9Y2B2
• Background: This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008]
• Synonyms: CHIME
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways