Antibodies

Jump to Filters
View as table Download
PKIB Rabbit Polyclonal Antibody
TA314384

USD 345.00

In Stock

Rabbit polyclonal anti-IPKB antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IPKB.
PKIB Rabbit Polyclonal Antibody
TA344652

USD 475.00

5 Days

Rabbit Polyclonal Anti-PKIB Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pkib antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA