PKIB Rabbit Polyclonal Antibody

CAT#: TA344652

Rabbit Polyclonal Anti-PKIB Antibody - middle region

Product Images

WB Suggested Anti-Pkib Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pkib antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: protein kinase (cAMP-dependent, catalytic) inhibitor beta
• Database Link:
  NP_861460
  Entrez Gene 24678 Rat
  UniProt ID Q9C010
• Background: Pkib displays strong inhibition of the activity of cAMP-dependent protein kinase.
• Synonyms: PRKACN2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 92%; Guinea pig: 92%; Dog: 90%; Horse: 90%; Bovine: 90%; Goat: 85%

Reference Data

• Protein Families: Druggable Genome