Antibodies

Jump to Filters
View as table Download
phospholipid scramblase 2 (PLSCR2) Rabbit Polyclonal Antibody
TA331284

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLSCR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLSCR2 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSCR2. Synthetic peptide located within the following region: PVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLD