phospholipid scramblase 2 (PLSCR2) Rabbit Polyclonal Antibody

CAT#: TA331284

Rabbit Polyclonal Anti-PLSCR2 Antibody

Product Images

WB Suggested Anti-PLSCR2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLSCR2 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSCR2. Synthetic peptide located within the following region: PVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: phospholipid scramblase 2
• Database Link:
  NP_065092
  Entrez Gene 57047 Human
  UniProt ID Q9NRY7
• Background: This gene encodes a member of the phospholipid scramblase family. Phospholipid scramblases are membrane proteins that mediate calcium-dependent, non-specific movement of plasma membrane phospholipids and phosphatidylserine exposure. The encoded protein contains a low affinity calcium binding motif and may play a role in blood coagulation and apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: phospholipid scramblase 2
• Note: Human: 100%; Rabbit: 79%; Pig: 75%; Rat: 75%