Rabbit Polyclonal Anti-POGZ Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POGZ antibody: synthetic peptide directed towards the N terminal of human POGZ. Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA |
Rabbit Polyclonal Anti-POGZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POGZ antibody: synthetic peptide directed towards the C terminal of human POGZ. Synthetic peptide located within the following region: ASLEEQLKLSGEHSESSTPRPRSSPEETIEPESLHQLFEGESETESFYGF |
Rabbit polyclonal anti-Pogz antibody
| Applications | WB |
| Reactivities | Human, Dog, Short-tailed Opossum, Bovine, Rat, Chimpanzee, Macaque, Olive Baboon, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of mouse Pogz protein. |
Rabbit Polyclonal Anti-POGZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POGZ Antibody: synthetic peptide directed towards the middle region of human POGZ. Synthetic peptide located within the following region: STMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPT |
Germany
Japan
United Kingdom
China
