Antibodies

Jump to Filters
View as table Download
BRN4 (POU3F4) Rabbit Polyclonal Antibody
TA330129

USD 310.00

5 Days

Rabbit Polyclonal Anti-POU3F4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POU3F4 antibody: synthetic peptide directed towards the C terminal of human POU3F4. Synthetic peptide located within the following region: ADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL
BRN4 (POU3F4) Rabbit Polyclonal Antibody
TA380180

USD 220.00

3 Weeks

POU3F4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human POU3F4 (NP_000298.3).
Modifications Unmodified