Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PRMT5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRMT5 antibody: synthetic peptide directed towards the N terminal of human PRMT5. Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS |
Goat Anti-PRMT5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RACREKDRDPEAQ, from the internal region of the protein sequence according to NP_006100.2; NP_001034708.1. |
Rabbit polyclonal anti-PRMT-5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 51 of rat PRMT-5 |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI1F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-PRMT5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 622-637 amino acids of human protein arginine methyltransferase 5 |
PRMT5 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human PRMT5 (NP_006100.2). |
| Modifications | Unmodified |
Recombinant Anti-PRMT5 (Clone RAB-C136)
| Applications | ChIP, ELISA, IF |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-PRMT5 (Clone RAB-C136)
| Applications | ChIP, ELISA, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PRMT5 mouse monoclonal antibody,clone OTI1F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRMT5 mouse monoclonal antibody,clone OTI1F8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PRMT5 mouse monoclonal antibody,clone OTI1F8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PRMT5 mouse monoclonal antibody,clone OTI1F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- PRMT5