Antibodies

View as table Download

Rabbit Polyclonal Anti-PRR7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRR7 antibody: synthetic peptide directed towards the middle region of human PRR7. Synthetic peptide located within the following region: AEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRG

PRR7 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse PRR7