Antibodies

Jump to Filters
View as table Download
PRSS8 Rabbit Polyclonal Antibody
TA342158

USD 375.00

5 Days

Rabbit polyclonal Anti-PRSS8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRSS8 antibody: synthetic peptide directed towards the middle region of human PRSS8. Synthetic peptide located within the following region: PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE
PRSS8 Rabbit Polyclonal Antibody
TA351559

USD 345.00

In Stock

Rabbit Polyclonal Anti-PRSS8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRSS8
PRSS8 Rabbit Polyclonal Antibody
TA367208

USD 380.00

4 Weeks

PRSS8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRSS8
PRSS8 Rabbit Polyclonal Antibody
TA380429

USD 220.00

3 Weeks

PRSS8 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human PRSS8 (NP_002764.1).
Modifications Unmodified