PRSS8 Rabbit Polyclonal Antibody

CAT#: TA342158

Rabbit polyclonal Anti-PRSS8 Antibody

Product Images

WB Suggested Anti-PRSS8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRSS8 antibody: synthetic peptide directed towards the middle region of human PRSS8. Synthetic peptide located within the following region: PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: protease, serine 8
• Database Link:
  NP_002764
  Entrez Gene 5652 Human
  UniProt ID Q16651
• Background: This gene encodes a trypsinogen, which is a member ofThe trypsin family of serine proteases.This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid.The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involvingThe carboxyl group of lysine or arginine. [provided by RefSeq, Jul 2008]
• Synonyms: CAP1; PROSTASIN
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein