Rabbit Polyclonal Anti-PSMC3IP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMC3IP antibody: synthetic peptide directed towards the middle region of human PSMC3IP. Synthetic peptide located within the following region: RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP |
Rabbit Polyclonal Anti-PSMC3IP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMC3IP antibody: synthetic peptide directed towards the C terminal of human PSMC3IP. Synthetic peptide located within the following region: PEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIE |
Germany
Japan
United Kingdom
China