PSMC3IP Rabbit Polyclonal Antibody

CAT#: TA342445

Rabbit Polyclonal Anti-PSMC3IP Antibody

Product Images

WB Suggested Anti-PSMC3IP Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMC3IP antibody: synthetic peptide directed towards the middle region of human PSMC3IP. Synthetic peptide located within the following region: RLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: PSMC3 interacting protein
• Database Link:
  NP_057640
  Entrez Gene 29893 Human
  UniProt ID Q9P2W1
• Background: This gene encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2011]
• Synonyms: GT198; HOP2; HUMGT198A; ODG3; TBPIP
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Goat: 86%; Mouse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome