Germany
Japan
United Kingdom
China
PSMD9 mouse monoclonal antibody, clone p27(26S-104), Supernatant
| Applications | IF, IP, WB |
| Reactivities | Xenopus |
Antibodies
View as table DownloadRabbit anti-PSMD9 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMD9 |
Rabbit Polyclonal Anti-PSMD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD9 antibody: synthetic peptide directed towards the middle region of human PSMD9. Synthetic peptide located within the following region: QVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAM |
Rabbit Polyclonal Anti-PSMD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD9 antibody: synthetic peptide directed towards the C terminal of human PSMD9. Synthetic peptide located within the following region: QSLHNIGSVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIP |
Anti-PSMD9 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
PSMD9 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSMD9 |
USD 420.00
4 Weeks
Active filters
Target Symbol
- PSMD9