Rabbit Polyclonal Anti-QTRT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-QTRT1 antibody: synthetic peptide directed towards the N terminal of human QTRT1. Synthetic peptide located within the following region: FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG |
Rabbit Polyclonal Anti-QTRT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-QTRT1 antibody: synthetic peptide directed towards the middle region of human QTRT1. Synthetic peptide located within the following region: KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL |
QTRT1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human QTRT1 |
QTRT1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human QTRT1 |
Germany
Japan
United Kingdom
China