Goat Polyclonal Anti-Rab35 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab35 produced in E. coli. |
Goat Polyclonal Anti-Rab35 Antibody
| Applications | WB |
| Reactivities | Detects Rab35 in cell lysates and transfected cells by Western blot. |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab35 produced in E. coli. |
Rabbit Polyclonal Anti-RAB35 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB35 antibody: synthetic peptide directed towards the middle region of human RAB35. Synthetic peptide located within the following region: RTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGN |
Rabbit Polyclonal Anti-RAB35 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB35 antibody: synthetic peptide directed towards the middle region of human RAB35. Synthetic peptide located within the following region: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK |
Anti-RAB35 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 121-135 amino acids of Human Ras-related protein Rab-35 |
RAB35 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human RAB35 (NP_006852.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
