Antibodies

Jump to Filters
View as table Download
Rabex5 (RABGEF1) Rabbit Polyclonal Antibody
TA319896

USD 430.00

5 Days

Rabbit Polyclonal RABEX5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RABEX5 antibody was raised against a 19 amino acid synthetic peptide near the center terminus of human RABEX5.
Rabex5 (RABGEF1) Rabbit Polyclonal Antibody
TA334545

USD 375.00

5 Days

Rabbit Polyclonal Anti-RABGEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RABGEF1 antibody: synthetic peptide directed towards the N terminal of human RABGEF1. Synthetic peptide located within the following region: MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ